# Pets and Animals → Pets

- **Type:** industry
- **Total brands:** more than 10,000
- **Page:** 128 of 200

## Brands on this page

| Brand | Domain | Description |
| --- | --- | --- |
| [Westview Veterinary Services](/westviewvet.com.md) | `westviewvet.com` | Westview Veterinary Services is dedicated to providing high-quality veterinary care for the North Vancouver, BC community. |
| [Westway Animal Clinic](/westwaydvm.com.md) | `westwaydvm.com` | Our veterinarians in Toronto are dedicated to strengthening your bond with your pet through the highest-quality medicine. |
| [We Teach Pets](/weteachpets.com.md) | `weteachpets.com` | I'm Naomi Andrews, I provide support with dog training for anxious dogs and other stress related behaviour in Worcestershire & online. |
| [Wetnose Animal Aid](/wetnoseanimalaid.com.md) | `wetnoseanimalaid.com` | Hedgehog Rescue Numbers for Bungay/Beccles/Loddon/Ditchingham areas. Hog HouseLong Stratton07766 913370 Hedgehog HavenOulton Broad07584 297480 Brocksbarn Hedgeh |
| [Wheatland Animal Hospital](/wheatlandanimalhospital.com.md) | `wheatlandanimalhospital.com` | Now welcoming new clients! Wheatland Animal Hospital is a family-owned practice in Naperville, Illinois, dedicated to providing exceptional medical care in a ca |
| [Wheaton AH](/wheatonanimalhospital.com.md) | `wheatonanimalhospital.com` | Wheaton Animal Hospital is dedicated to providing high-quality veterinary care for the Glen Ellyn, IL community. |
| [Whiskers and Tails](/whiskersandtailssanctuary.org.md) | `whiskersandtailssanctuary.org` | Helping pets and animals in west Texas. |
| [White Bear AH](/whitebearanimalhospital.com.md) | `whitebearanimalhospital.com` | Compassionate animal hospital and veterinary clinic in White Bear Lake, MN offering wellness exams, pet vaccinations, diagnostics, dental care, surgery, and tai |
| [News from](/whitecliffsvets.com.md) | `whitecliffsvets.com` | We are a dedicated team of Veterinary professionals serving clients across Whitfield East and West Langdon Alkham, Coldred. Find out more about our practice her |
| [Whitelands Animal Hospital](/whitelandsah.com.md) | `whitelandsah.com` | Welcome to Exceptional Pet Care and Service! Welcome to Whitelands Animal Hospital where you will find exceptional pet care combined with personalized service.  |
| [Lovet Pet Health Care](/whitetanksah.com.md) | `whitetanksah.com` | Discover exceptional veterinary care at Lovet in Surprise, AZ, offering urgent care to wellness exams, surgery, and more for your pet’s health journey. |
| [WHITEWATER VET HOSPITALAt](/whitewatervethospital.com.md) | `whitewatervethospital.com` | Whitewater Veterinary Hospital is your local Veterinarian in Whitewater serving all of your needs. Call us today at 262-473-2930 for an appointment. |
| [Whuffle Pets](/whufflepets.com.md) | `whufflepets.com` | We offer a wide range of merchandise designed to celebrate this unique bond. From stylish apparel for both you and your pet to fun and functional accessories, o |
| [WiggleLess](/wiggleless.com.md) | `wiggleless.com` | Stop dog back pain and twisting! Discover the WiggleLess Back Brace, the ideal solution for IVDD, plus products for mobility, anxiety, and post-op recovery. |
| [Wilbury Vets](/wilburyvets.co.uk.md) | `wilburyvets.co.uk` | Wilbury Vets are a boutique veterinary practice in Brighton and Hove. We offer a tailored, more personal experience for pet owners who value complete peace of m |
| [Wildcat Vet Services](/wildcatvetservices.com.md) | `wildcatvetservices.com` | Home in Manhattan, KS. Wildcat Vet Services is your local Veterinarian in Manhattan serving all of your needs. Call us today at 785-320-2770 for an appointment. |
| [Wild Paws](/wildpawscolorado.com.md) | `wildpawscolorado.com` | Wild Paws is the top-rated pet service provider in Douglas County, CO, with 150+ five-star reviews, 100% reliability, and mobile app-based booking. Start your p |
| [Me Wildside Unlimited](/wildsideunlimited.com.md) | `wildsideunlimited.com` | Discover award-winning dog trainers at Wildside Unlimited in Key West and the Florida Keys. Join our AKC certified classes and private sessions. Dog trainer nea |
| [Wildwood Veterinary Clinic](/wildwoodvetclinic.com.md) | `wildwoodvetclinic.com` | Portland, Oregon's Wildwood Veterinary Clinic provides high-quality veterinary care and exceptional customer service in a family-oriented environment. |
| [Wilhite&FreesEquine](/wilhiteandfrees.com.md) | `wilhiteandfrees.com` | Wilhite and Frees Equine Hospital is your local Veterinarian in Peculiar serving all of your needs. Call us today at 816-779-0100 for an appointment. |
| [Williamsburg Animal Clinic](/williamsburganimalclinic.com.md) | `williamsburganimalclinic.com` | A simple promise When your pet comes through our doors, we make a promise to care for them like we would our own. We do the same for you, too. We believe that v |
| [Williamsburg vet](/williamsburgvetny.com.md) | `williamsburgvetny.com` | Williamsburg Animal Clinic is a full-service animal hospital serving the pets and families of Brooklyn, NY. |
| [Williams County Humane Society](/williamscountyhumanesociety.com.md) | `williamscountyhumanesociety.com` | Williams County Humane Society is a community-based, nonprofit organization dedicated to the welfare of homeless and abandoned animals. |
| [Wags and Whiskers Veterinary Service](/williamsfieldveterinaryservice.com.md) | `williamsfieldveterinaryservice.com` | Wags and Whiskers Veterinary Services, PLLC, Veterinary Clinic, Animal Clinic provides veterinary services in Williamsfield & Elmwood. Call us at 309-742-3800 t |
| [Willow Grace Veterinary Hospital](/willowgraceveterinaryhospital.com.md) | `willowgraceveterinaryhospital.com` | Willow Grace Veterinary Hospital - Visit our skilled Veterinarian in Delaware. Accepting new appointments. Call today or request an appointment online. |
| [Willow Wood Pet](/willowwoodpetresort.com.md) | `willowwoodpetresort.com` | Willow Wood Pet Resort & Training Center provides professional pet care services, including boarding, training, grooming and day care in Westerville, Columbus O |
| [Wilmington Animal Healthcare Veterinary Hospital](/wilmingtonanimalhealthcare.com.md) | `wilmingtonanimalhealthcare.com` | Wilmington Animal Healthcare Veterinary Hospital provides comprehensive pet care in Wilmington, NC. Call us today to schedule your pet's appointment with our ve |
| [Wilson Vet Co.](/wilsonvetco.com.md) | `wilsonvetco.com` | Wilson Vet Co. specializes in poultry health with comprehensive flock inspections, advanced diagnostics, and personalized care plans. Trust us for expert soluti |
| [Wilson Veterinary Hospital](/wilsonvethospital.com.md) | `wilsonvethospital.com` | Wilson Veterinary Hospital is a privately-owned small-animal emergency and specialty practice serving the Metro Detroit area. We offer 24-hour emergency and cri |
| [Wilvet Salem](/wilvetsalem.com.md) | `wilvetsalem.com` | Wilvet Salem Emergency's mission is to provide clients and their pets with high quality, progressive and compassionate emergency veterinary care. |
| [Winchester Road Animal Hospital](/winchesterroadanimalhospital.com.md) | `winchesterroadanimalhospital.com` | Compassionate veterinary hospital providing wellness exams, surgery, dental care, diagnostics, and boarding for dogs and cats. |
| [Windhaven Veterinary Hospital](/windhavenveterinaryhospital.com.md) | `windhavenveterinaryhospital.com` | Windhaven Veterinary Hospital is here to provide outstanding veterinary care to pets in Plano, TX. |
| [Windmill Vet](/windmillvet.com.md) | `windmillvet.com` | Abilene's premier veterinary clinic. Windmill Animal Hospital offers complete vet care, dog boarding, dog grooming and more in Abilene, TX. See more here |
| [4FurBaby](/wink-in.com.md) | `wink-in.com` | 4FurBaby for every 4-legged pet baby-keep your pet clean and comfortable every day—discover 4FurBaby’s premium biodegradable wipes! Gentle, hypoallergenic, and  |
| [4FurBaby](/wink-in.com.md) | `wink-in.com` | 4FurBaby for every 4-legged pet baby-keep your pet clean and comfortable every day—discover 4FurBaby’s premium biodegradable wipes! Gentle, hypoallergenic, and  |
| [Winter Garden Animal Hospital](/wintergardenanimalhospital.com.md) | `wintergardenanimalhospital.com` | Winter Garden Animal Hospital provides affordable, compassionate veterinary care to pets in and around the Winter Garden area. Visit us or schedule online today |
| [Wintermere Pointe Animal Hospital](/wintermerepointevet.com.md) | `wintermerepointevet.com` | We're a full-service veterinary clinic located in Winter Garden, FL providing pet exams, pet dentistry, and more. Call (407) 602-1684 for an appointment! |
| [Winterville Animal Clinic](/wintervilleanimalclinic.com.md) | `wintervilleanimalclinic.com` | Winterville Animal Clinic is a vet clinic for cats and dogs in the Athens, GA area. Our veterinarians provide complete veterinary care for every stage of your p |
| [Wire2Wire](/wire2wirevetproducts.com.md) | `wire2wirevetproducts.com` | Explore top-quality vet products supply, animal wellness products, and veterinary supplies at Wire2Wire Vet Products—innovative solutions for your pets and anim |
| [Ge](/wirralwoofpack.com.md) | `wirralwoofpack.com` | Welcome to The Wirral Woof Pack Here at The Wirral Woof Pack we always aim to provide the best care to your pets during our walks and day-care sessions. All of  |
| [Wisconsin Pet Care](/wisconsinpetcare.com.md) | `wisconsinpetcare.com` | Reliable and professionally-trained dog walkers & in-home pet sitters in Milwaukee, Kenosha, Racine, Shorewood, and Whitefish Bay. Call us today! |
| [Wisdom Pet Medicine](/wisdompets.com.md) | `wisdompets.com` | Wisdom Pet Medicine strives to blend the best in traditional and alternative medicine in the diagnosis and treatment of companion animals including dogs, cats,  |
| [Wishbone Pet Rescue](/wishbonepetrescue.org.md) | `wishbonepetrescue.org` | Wishbone Pet Rescue in Allegan County, MI: Adopt, foster, volunteer, donate, and access low‑cost spay & neuter services. Help pets find loving forever homes! |
| [Trimming Edge Lawn Care](/wolfiespetcare.com.md) | `wolfiespetcare.com` | Trimming Edge provides personalized pet care, including grooming & pet sitting. Trust our 25 years of experience for your pet's happiness! |
| [Wood Dale Pet Pharmacy](/wooddalecompounding.com.md) | `wooddalecompounding.com` | Discover Wood Dale Pharmacy's bark-tacular pet meds, made-to-order for your furry pals with free shipping and a caring support team! |
| [Wood Dale Pet Pharmacy](/wooddalecompoundingpharmacy.com.md) | `wooddalecompoundingpharmacy.com` | Discover Wood Dale Pharmacy's bark-tacular pet meds, made-to-order for your furry pals with free shipping and a caring support team! |
| [Wood Dale Pet Pharmacy](/wooddalepetrx.com.md) | `wooddalepetrx.com` | Discover Wood Dale Pharmacy's bark-tacular pet meds, made-to-order for your furry pals with free shipping and a caring support team! |
| [Wood Dale Pet Pharmacy](/wooddalepetscompoundingpharmacy.com.md) | `wooddalepetscompoundingpharmacy.com` | Discover Wood Dale Pharmacy's bark-tacular pet meds, made-to-order for your furry pals with free shipping and a caring support team! |
| [Triangle Animal Clinic](/woodlandanimalhospital.com.md) | `woodlandanimalhospital.com` | The Grove Animal Hospital is committed to providing quality, compassionate care year round in Henry County. Call our veterinarians in Locust Grove, GA! |
| [Woodland Trails Animal Hospital](/woodlandtrailsanimalhospital.com.md) | `woodlandtrailsanimalhospital.com` | Woodland Trails Animal Hospital in Edmond, OK is a full-service veterinary medical facility, located in Edmond, Oklahoma. |

## Pagination

[← Previous page](/explore/industry/pets-and-animals/pets.md?page=127) · [Next page →](/explore/industry/pets-and-animals/pets.md?page=129)

---

_Source: <https://brandfetch.com/explore/industry/pets-and-animals/pets?page=128>_
_See [/llms.txt](/llms.txt) for a full list of agent-readable pages, and [/auth.md](/auth.md) for how agents authenticate._