# Travel and Tourism → Ground Transportation

- **Type:** industry
- **Total brands:** 2,650
- **Page:** 19 of 53

## Brands on this page

| Brand | Domain | Description |
| --- | --- | --- |
| [1-2 Call Cars Ltd](/12callcars.co.uk.md) | `12callcars.co.uk` | Andover Providing top-quality services throughout Andover. Trusted Services Across Andover Delivering fast, reliable solutions throughout the Andover region. Ba |
| [1st Bus Stop Limited](/1stbusstop.co.uk.md) | `1stbusstop.co.uk` | At 1st Bus Stop, we offer comprehensive coach, bus, and minibus services tailored to meet your transportation needs. Our fleet of fully insured vehicles is hand |
| [24x7 Limo](/24x7limo.ca.md) | `24x7limo.ca` | Limousine Services And Limo Rentals In Vancouver, BC - 24x7 Limo. The best luxury limo service and VIP treatment you would expect from a top Vancouver Limousine |
| [2 WayTransport](/2waycoaches.co.uk.md) | `2waycoaches.co.uk` | 2 Way Coach Hire North Lincolnshire provides safe, reliable coaches across North Lincolnshire. We have a fleet of coaches ranging from 8 seaters up to 85 seats |
| [3A Locadora](/3alocadora.com.br.md) | `3alocadora.com.br` | Alugue veículos com a 3A Locadora: variedade de carros, preços competitivos e atendimento ágil em Natal/RN. |
| [845 Transportation](/845transportation.com.md) | `845transportation.com` | 845 Transportation & 845 Ride Car Service serving Dutchess County, NY, Corporate, airport, event transportation |
| [AAA VIP Limos](/aaaviplimos.com.md) | `aaaviplimos.com` | Book Limo Service Winnipeg for a safe and comfortable journey to your events. Luxury vehicles with professional drivers await you. |
| [AA Chauffeur Services](/aachauffeurservices.com.au.md) | `aachauffeurservices.com.au` | At AA Chauffeur Services, Chauffeur Hire Melbourne & Fixed Price Chauffeur Service in Melbourne, get private Chauffeur car luxury premium Chauffeur Melbourne. |
| [Adeo Transfer](/adeotransfer.com.md) | `adeotransfer.com` | Chauffeur privé 7j/7 et 24h/24 pour vos transferts gare, aéroport et sorties. Adeo Transfer VTC propose ses tarifs et réservation en ligne. |
| [Admiral Cars](/admiraltaxisbanbury.co.uk.md) | `admiraltaxisbanbury.co.uk` | Airport transfers Banbury. Hire an affordable taxi service from banbury to heathrow taxi, Gatwick, Birmingham and all major UK airports. |
| [PRESTIGE LIMO PARIS](/adpserviceprestige.fr.md) | `adpserviceprestige.fr` | PRESTIGE LIMO PARIS Réservez en ligne votre Chauffeur Privé Aéroports et Gares Réserver en ligne votre transfert depuis et vers un aéroport, une gare ou votre d |
| [Aerial Town Car & Limousine](/aeriallimos.com.md) | `aeriallimos.com` | On Time, Every Time! 24/7 airport pick up & drop off service trusted since 2010. Reliable point-to-point transportation, prompt airport car service (covering Lo |
| [Fleet](/afleetforchange.org.md) | `afleetforchange.org` | We are reclaiming the night for women and vulnerable people with our new breed of safe, shared transport in Sheffield. Fleet bridges the gap between public tran |
| [Держи Каву](/agarintur.com.md) | `agarintur.com` | Arın Group ile sizlere güvenli ve konforlu hizmetler sunmak için çalıÅmaktayız. Personel taÅ., ÃÄrenci taÅ., VIP transfer, Havalimanı transferi, Otob |
| [Dispatch Limousine CallCenter](/aidispatchservices.com.md) | `aidispatchservices.com` | 24/7 LIMOUSINE CALL CENTER:Dispatch and Answering ServicesWelcome to our premier limousine call center, where luxury meets convenience! At our fingertips, we ha |
| [Airline Crew Trans](/airlinecrewtrans.com.md) | `airlinecrewtrans.com` | Professional airline crew transportation services. Reliable, safe, and comfortable rides for airline crews in the Bay Area. |
| [Baku Airport Transfer Services](/airporttransferbaku.com.md) | `airporttransferbaku.com` | Book your Baku airport transfer with Baku Airport Tranfser Services for safe, reliable, and affordable rides in Azerbaijan. |
| [AJL Transfer](/ajltransfer.com.md) | `ajltransfer.com` | AJL Transfer offers premium airport transfers, chauffeur services, inter-city rides, hourly bookings and luxury transport across Switzerland. 24/7 support, prof |
| [A&J Taxis](/ajtaxis.co.uk.md) | `ajtaxis.co.uk` | A&J Taxis - North Wales leading eco taxi firm, offering local taxis and airport transfers. 16 Seater Minibuses. Business rates available. BOOK ONLINE or VIA APP |
| [All The Way Limo](/allthewaylimo.net.md) | `allthewaylimo.net` | Are you looking for luxury transportation for your next trip while in Pennsylvania? All The Way Limo got you! Contact us today to learn more. |
| [ALPY](/alpinetransfer.ch.md) | `alpinetransfer.ch` | Book family-friendly private ski transfers & Geneva Airport ski taxi services. Comfortable shuttles and taxis from Geneva to Alpine resorts with trusted drivers |
| [AMINA GmbH](/amina-verbund.de.md) | `amina-verbund.de` | AMINA ASCHAFFENBURG MILTENBERG NAHVERKEHRS-GMBH AMINA ASCHAFFENBURG MILTENBERG NAHVERKEHRS-GMBH AKTUELLES SCHULLEITFADEN Präambel - Leitfaden für Schulen zur Sc |
| [Anetra](/anetra.es.md) | `anetra.es` | Defendemos los intereses de nuestros asociados y del Sector del Transporte de Viajeros por Carretera, en todos los ámbitos: Jurídico, administrativo, legislativ |
| [ARC Electric](/arcelectric.in.md) | `arcelectric.in` | ARC Electric is India's leading B2B platform for EV Cabs. |
| [Arizona Executive LLC](/arizonaexecutivellc.com.md) | `arizonaexecutivellc.com` | Phoenix and Scottsdale affordable airport transportation. Executive SUV services to and from Sky Harbor International Airport. |
| [Arocena Minibuses](/arocenaminibuses.com.uy.md) | `arocenaminibuses.com.uy` | Somos una empresa con mas de 20 años dedicado al transporte de pasajeros en territorio nacional e internacional. Nos encontramos en el centro de Carrasco a cinc |
| [Around Atlanta Limousines \| Atlanta GA](/aroundatllimos.com.md) | `aroundatllimos.com` | Experience luxury Limo service with Around Atlanta Limousines. Book SUV limos & Car services for corporate travel, events & airport transfers in Atlanta, GA. |
| [A-SERVICES](/aservicestransfer.be.md) | `aservicestransfer.be` | Professioneel vervoer in Tervuren, Brussels en omstreken. A‑Services biedt chauffeurservice, betrouwbare luchthaventransfers en comfortabele ‘Business Class’-vo |
| [Asher's Limo Service](/asherslimoservice.com.md) | `asherslimoservice.com` | We provide chauffeured car and limo services in Gainesville, Lake City, Ocala, FL., and airport transfer services to/from GNV, JAX, OCF, MCO, TPA |
| [Astra Autotrasporti Stradali Srl Autolinee](/astraautolinee.com.md) | `astraautolinee.com` | Astra Autolinee offre noleggio autobus e collegamenti sicuri in Sicilia. Contattaci oggi stesso per viaggi confortevoli in Sicilia. ti aspettiamo! |
| [ASTT](/astt.fr.md) | `astt.fr` | wintechgroupepices-millesaveurslequipe228padfaosworldcompanyaspamnewsamenageriecfdtdiviaclicinformatique62studiostendeserralevelvettagencetilmoncreditinfobubenh |
| [ATHENS TAXI DRIVER](/athens-taxi-driver.gr.md) | `athens-taxi-driver.gr` | Book Athens taxi & private chauffeur services for airport transfers, tours and intercity rides in Greece. Fixed prices & professional drivers. |
| [Autobuses Herrera](/auherrera.es.md) | `auherrera.es` | Transporte de autobuses líneas metropolitanas, discrecionales, rutas regulares Viaje en autobus EMISIONES |
| [Auto Andalucía Bus](/autoandaluciabus.es.md) | `autoandaluciabus.es` | Empresa de autobuses en Sevilla: alquiler de autocares en Sevilla con conductor. Disponemos de una amplia flota y 30 años de experiencia |
| [Société des Cars Alpes Littoral](/autocars-scal.fr.md) | `autocars-scal.fr` | Avec la SCAL voyagez en toute confiance sur nos lignes régulières LER Zou : lignes en région PACA pour vos voyages en groupe. La SCAL dispose d'une large gamme  |
| [Autolinee Giachino](/autolineegiachino.it.md) | `autolineegiachino.it` | Autolinee Giachino s.r.l. noleggio autobus turismo noleggio pullman bus con conducente viaggi minibus granturismo trasporto autolinee Torino, Piemonte, italia |
| [Autos Frutos](/autosfrutos.es.md) | `autosfrutos.es` | INICIO EMPRESA SERVICIOS FLOTA CONTACTO BLOG AUTOS FRUTOS TV ACCESO CLIENTES Idiomas Bienvenidos a Autos Frutos Autos Frutos Confort y Elegancia en Movimiento s |
| [AVO Group](/avogroup.es.md) | `avogroup.es` | Servicios de transporte de viajeros y alquiler de autobuses en Málaga, Costa del Sol |
| [Aznur](/aznur.az.md) | `aznur.az` | Explore Baku with AZNUR rent a car in Baku. Top-quality vehicles for city or country trips at great rates. Rent a car Baku and Azerbaijan. Book your adventure |
| [Basking Ridge Limousines Worldwide](/baskingridgelimousineservices.com.md) | `baskingridgelimousineservices.com` | Book top-rated limousine services for weddings, airport transfers, and events. Enjoy luxury limo rentals, chauffeur service, and executive car travel 24/7. |
| [Bay Town Car Services Ltd](/baytowncarservices.co.uk.md) | `baytowncarservices.co.uk` | Bay Town Car Services provide door-to-door transfers for business trips, holidays, and special occasions. |
| [Black Car Connection](/blackcarconnection.com.md) | `blackcarconnection.com` | We answer our phones 24/7 and specialize in providing luxurious, prompt, and friendly transportation worldwide. You will get a late model vehicle that is clean  |
| [BLACK CAR LIVERY SERVICE](/blackcarlivery.ca.md) | `blackcarlivery.ca` | Limo Services in Toronto - Welcome to our prestigious limousine transportation services in Toronto, where we offer quality service at affordable prices. |
| [Blueline Chauffeurs](/bluelinechauffeurs.co.uk.md) | `bluelinechauffeurs.co.uk` | Discover premium luxury chauffeur services with Blueline Chauffeurs in the United Kingdom. Book now for an exceptional journey. |
| [Blue Prestige VTC](/blueprestigevtc.com.md) | `blueprestigevtc.com` | Blue Prestige VTC est une agence spécialisée dans la location de Véhicule de Tourisme avec Chauffeur ou VTC en Île-de-France et sur Paris. |
| [BOBLeek](/bobleek.nl.md) | `bobleek.nl` | Taxi nodig in Leek, Tolbert, Roden, Zevenhuizen of Groningen? BOBLeek regelt vervoer van personen en documenten. Gecertificeerd, discreet en veilig. |
| [Booking Transfer](/bookingtransfer.me.md) | `bookingtransfer.me` | Book affordable and reliable private airport transfers with BookingTransfer.me. We serve Serbia, Croatia, Montenegro, and more with easy booking and no hidden f |
| [BORJAN](/borjan.co.uk.md) | `borjan.co.uk` | Ride in luxury with Borjan Executive Cars. We offer comfortable transportation in Mercedes taxis to all Oxford airports at affordable prices. Book now! |
| [BRT-ABC](/brtabc.com.br.md) | `brtabc.com.br` | O BRT-ABC chega para preencher antiga demanda dos moradores do Grande ABCDMR por um transporte de ligação com os modais de transporte de massa – Sistema Metrovi |
| [Brussels-Minibus.be ️ Prestige Drive  Atlantis Chauffeur  Van](/brussels-minibus.be.md) | `brussels-minibus.be` | Location de véhicules et minibus avec chauffeur privé à Bruxelles et en Belgique pour vos événements. Confort, prestige et chauffeurs multilingues garantis. |

## Pagination

[← Previous page](/explore/industry/travel-and-tourism/ground-transportation.md?page=18) · [Next page →](/explore/industry/travel-and-tourism/ground-transportation.md?page=20)

---

_Source: <https://brandfetch.com/explore/industry/travel-and-tourism/ground-transportation?page=19>_
_See [/llms.txt](/llms.txt) for a full list of agent-readable pages, and [/auth.md](/auth.md) for how agents authenticate._