# Travel and Tourism → Ground Transportation - **Type:** industry - **Total brands:** 6,868 - **Page:** 88 of 138 ## Brands on this page | Brand | Domain | Description | | --- | --- | --- | | [Transfers VIP Malaga](/transfersvipmalaga.com.md) | `transfersvipmalaga.com` | Prices are all-inclusive, transfer from/to Malaga Airport, transfer from train station, car hire with driver. Call us now. | | [BVB.net](/bvb.net.md) | `bvb.net` | Bus hire for every occasion: Group trips, shuttle services, school trips and more. BVB.net - your professional for comfortable and safe mobility. | | [Midyat-Estel Taksi](/midyatesteltaksi.com.md) | `midyatesteltaksi.com` | midyat taksi, estel taksi, midyatestel taksi, mardin taksi, midyat turizm taksi, mardin havalimanı taksi, şırnak havalimanı taksi, özel kurye taksi, | | [Top G towing](/topgtowing.com.md) | `topgtowing.com` | Towing Since 2009 Make a trip Who are we? We aim to become the best in the market by providing safe and reliable services for our valued customers. We want ever | | [Best Transit](/besttransit.net.md) | `besttransit.net` | A fully insured, licensed, and an approved vendor of the city of Philadelphia as well as the state of Pennsylvania. Our services include Corporate Shuttles, Non | | [Moms on Wheels](/momsonwheels.com.md) | `momsonwheels.com` | Moms on Wheels\| Worry-free solution to your child's transportation needs \| Charlotte, NC and surrounding cities \| Affordable Cost | | [Traffic On Maps](/trafficonmaps.com.md) | `trafficonmaps.com` | Get the latest traffic info, including traffic reports, directions, road conditions, from "Traffic on maps today" | | [Luxury Limousines \| Las Vegas NV](/luxurylimousineoflasvegas.com.md) | `luxurylimousineoflasvegas.com` | Book 24/7 Las Vegas limo service, airport transportation, party buses, Sprinter vans, weddings and private tours. Call 702-499-9000 for pricing. | | [Antalya Havalimanı VIP Transfer](/antalyahavalimaniviptransfer.com.md) | `antalyahavalimaniviptransfer.com` | Antalya Havalimanı VIP Transfer firmamız VIP Transfer Antalya, profesyonel otel transferleriniz için hizmetinizdedir. | | [RegioJet](/regiojet.de.md) | `regiojet.de` | Entdecken Sie Europa an Bord der gelben Bussen von RegioJet. Morderne Züge und Busse mit tollem Service warten bereits auf Sie. Buchen Sie Tickets zum besten Pr | | [· Naguebona](/naguebona.com.md) | `naguebona.com` | Naguebona: el taxi de Venezuela. Ya sabes lo que vas a pagar antes de que te lleven. Precio cerrado en USD, cobro en bolívares al oficial. | | [Universal Traslados](/remisesuniversal.com.md) | `remisesuniversal.com` | Universal Traslados ofrece soluciones de movilidad premium en Argentina, orientadas a clientes empresariales, diplomáticos, artísticos y eventos de alta gama. C | | [Taxi Bermeo Mikel](/taxibermeomikel.com.md) | `taxibermeomikel.com` | Servicio de Taxi24h en Bermeo Sobre Taxi Bermeo Mikel En Taxi Bermeo Mikel, ofrezco servicios de transporte confiables y seguros las 24 horas del día, todos los | | [Blackride Car Services](/blackridecarservice.com.md) | `blackridecarservice.com` | Explore premium limo, black car, and airport shuttle services with Blackride Car Services in Tampa. Book reliable, luxurious transportation for any occasion. | | [Traffar](/traffar.com.md) | `traffar.com` | Live traffic information and road conditions. Accidents, closures and restrictions on the map, right now and free of charge. | | [Sacramento Taxi Yellow Cab](/sacramentoyellowcabco.com.md) | `sacramentoyellowcabco.com` | We offer a Sacramento airport taxi service! SMF drop off & pick up 10-30% taxi discount Online By Sacramento Taxi Yellow Cab Service in Sacramento, CA | | [Odinrideshare](/odinrideshare.com.md) | `odinrideshare.com` | Travel with ease. Odinrideshare offers a seamless ride-sharing experience with quick pickups and trusted drivers. See your fare upfront and ride safely. Downloa | | [Utkarsh Valet](/utkarshvalet.com.md) | `utkarshvalet.com` | Need valet services for your event? Contact us today for a free quote! | | [Taxi Gironde](/taxi-gironde.com.md) | `taxi-gironde.com` | Taxi à Bordeaux et en Gironde. Transferts vers l’aéroport de Bordeaux-Mérignac, courses gare, mise à disposition 24 h/24 et 7 j/7. | | [Virasat Cabs](/virasatcabs.com.md) | `virasatcabs.com` | Book reliable taxi services with Virasat Cabs. We provide Delhi to Punjab Taxi, Punjab to Delhi One Way Cab, Delhi Airport Transfers, Outstation Taxi, Local Tax | | [GRV Yatrikha](/grvyatrikha.com.md) | `grvyatrikha.com` | Book your bus tickets with GRV Yatrikha today and make your trip memorable. Easy rescheduling, cancellation & live tracking features are available. | | [Coach Hire Durham](/coachhiredurham.com.md) | `coachhiredurham.com` | When you hire with Durham coach hire, one of our drivers with minibus or coach, will accommodate your group of any size for all types of ocassions | | [Airport Taxitransfer](/airport-taxitransfer.com.md) | `airport-taxitransfer.com` | Choose Luton Airport Taxi for stress-free airport transfers. Safe, fast, and reliable rides with professional drivers. Book your taxi now! | | [© American Elite Transportation](/americanelitetransportation.com.md) | `americanelitetransportation.com` | Discover unmatched luxury and comfort with our limo service in Orlando. Professional chauffeurs ensure a stress-free, stylish ride for any occasion. | | [Hummer Limo Ride](/hummerlimoride.com.md) | `hummerlimoride.com` | Need a Hummer limousine? Take a look at our available selection including cheap prices & images for all of our vehicles. Book your ride today! | | [Pink Tours and Travles](/pinktoursandtravels.com.md) | `pinktoursandtravels.com` | Pink Tours and Travles Provides one way and round trip outstation taxi service at low price . Book One Way & Round Trip Taxi at very low cost 24 x 7 customer su | | [GRS Travels](/grstravels.com.md) | `grstravels.com` | Book your bus tickets with GRS Travels today and make your trip memorable. Easy rescheduling, cancellation & live tracking features are available. | | [Sahasra Transport](/sahasratransport.com.md) | `sahasratransport.com` | Book your bus tickets with Sahasra Transport today and make your trip memorable. Easy rescheduling, cancellation & live tracking features are available. | | [Taxi Điện Tiền Giang](/taxidientiengiang.com.md) | `taxidientiengiang.com` | 0976649787 | | [Verbus](/verbus.com.md) | `verbus.com` | Location d'autocar avec chauffeur pour écoles, entreprises et événements. Devis rapide partout en France. | | [KS Cargo And Travels](/kscargoandtravels.com.md) | `kscargoandtravels.com` | Book your bus tickets with KS Cargo And Travels today and make your trip memorable. Easy rescheduling, cancellation & live tracking features are available. | | [Best Boston Car Service](/bestbostoncarservice.com.md) | `bestbostoncarservice.com` | Looking for reliable luxury transportation in Boston? Best Boston Car Service offers premium airport transfers, corporate travel, and private rides. Book today! | | [BLACK CAR LUX NEW YORK](/blackcarlux.com.md) | `blackcarlux.com` | Experience the finest chauffeur service in NY with Black Car Lux. On-time, discreet, and premium rides for business or leisure. | | [Global Drop Taxi](/globaldroptaxi.com.md) | `globaldroptaxi.com` | Reliable Drop Taxi Services in Tamil Nadu. Book our well-maintained vehicles and experienced drivers for a comfortable and safe ride. | | [CCLimo](/cclimo.ae.md) | `cclimo.ae` | Premium chauffeur and limousine service in Dubai & UAE. RTA licensed, 24/7 dispatch, executive fleet. Book your luxury ride today. | | [TransferMe Vip](/transfermevip.com.md) | `transfermevip.com` | TransferMe is the luxury and comfort of travel in Turkey. Enjoy being a Vip with TransferMe. | | [Amarnath Yatra Company](/amarnathyatracompany.com.md) | `amarnathyatracompany.com` | Amarnath Yatra Company — 35+ years of bus rental, tempo traveller, car rental, Yatra packages and tour packages across India, based in Jaipur, Rajasthan. | | [Sydney Silver Cabs Online](/sydneysilvercabsonline.com.md) | `sydneysilvercabsonline.com` | Welcome to Silver Taxi Sydney, a privately owned and operated company in Sydney, Australia - Airport Shuttle from Sydney | | [AK Tranz](/aktranz.com.md) | `aktranz.com` | Book your bus tickets with AK Tranz today and make your trip memorable. Easy rescheduling, cancellation & live tracking features are available. | | [Diya Bus](/diyabus.com.md) | `diyabus.com` | Book your bus tickets with Diya Bus today and make your trip memorable. Easy rescheduling, cancellation & live tracking features are available. | | [EasyBuyTransfer](/easybuytransfer.com.md) | `easybuytransfer.com` | VIP airport transfer booking worldwide. We connect you with travel agencies licensed by local tourism authorities — fixed price, instant confirmation, 24/7 supp | | [FHATA](/fhata.org.md) | `fhata.org` | ATA Bus - The Flint Hills Area Transportation Agency (aTa Bus) provides General Public Transportation/Transit for the Flint Hills Region. | | [Buster](/buster.com.md) | `buster.com` | Charter buses nationwide with Buster! Get instant quotes, easy DIY booking, and top-notch charter bus service. | | [Pacific Northwest Limo](/pacificnorthwestlimo.com.md) | `pacificnorthwestlimo.com` | Pacific Northwest Limousine provides town car transportation services for Seattle Seatac Airport, Weddings & Corporate events shuttles. Click to book now. | | [Viação Motta](/motta.com.br.md) | `motta.com.br` | Explore a melhor maneira de viajar pelo Brasil com a Motta! Compre Antes e Pague Menos. | | [1313 Executive](/1313executive.com.md) | `1313executive.com` | 1313 Executive - Premium executive transportation, limousine, and charter bus services in New York City and Indianapolis. 15 years of trusted service. NLA membe | | [1st Shuttle Service LLC](/1stshuttleservice.com.md) | `1stshuttleservice.com` | KANSAS CITY! 24 hours/day, 7 days/week, 365 days/year! We are there for you! Car seats & booster seats available. https://t.co/VHlMYqQldc 816-868-0202 | | [7AE Transport](/7aetransport.com.md) | `7aetransport.com` | TRAVEL WITH 7AE Emirates Wide Safely EveryWhere 7AE provide complete passengers transport & bus rental solution in the UAE. Our Fleet Our Featured The unique qu | | [89 Transfers](/89transfers.com.md) | `89transfers.com` | Expert Mallorca & Palma airport transfers. 100% local service. Map-based pickups, smart scheduling. Island-wide coverage. Book in 2 minutes. | | [ABIS Alpes Chauffeur](/abisalpeschauffeur.com.md) | `abisalpeschauffeur.com` | ABIS Alpes Chauffeur en Haute-Savoie propose transport privé, chauffeur, transferts aéroports, gares et déplacements pour particuliers et professionnels. | ## Pagination [← Previous page](/explore/industry/travel-and-tourism/ground-transportation.md?page=87) · [Next page →](/explore/industry/travel-and-tourism/ground-transportation.md?page=89) --- _Source: _ _See [/llms.txt](/llms.txt) for a full list of agent-readable pages, and [/auth.md](/auth.md) for how agents authenticate._